شنژن Haiwen Biotechnology Co.، Ltd. تولید پودر استروئیدها خام، روغن های نیمه تمام، مایع پایان، HGH، پپتیدها و مواد مخدر محلی آنستاتیک در چین است.

حراجی
درخواست نقل قول -
Select Language
خانه
محصولات
دربارهی ما
کارخانه تور
کنترل کیفیت
تماس با ما
درخواست نقل قول
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
خانهمحصولاتپودر رشد مو

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید

من محصولات خود را دریافت کرده ام، بسته بندی کنید، منحصر به فرد و کامل است، آن را واقعا من شگفت زده شده است. من در اسرع وقت بیشتر از شما سفارش. TKS!

—— Robet--Australia

من چندین بار با شما همکاری کرده ام، کیفیت محصول شما بسیار عالی است، به همین دلیل من هنوز محصولات خود را از شما خریداری می کنم. متشکرم

—— Richard---American

سلام مات، بهترین قیمت و محصول خلوص بالا در کشور من بسیار رقابتی است، این اجازه می دهد من سود بسیار، مشتریان من واقعا آن را دوست دارم. tks

—— Johnson---Canada

چت IM آنلاین در حال حاضر

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید supplier Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید supplier

تصویر بزرگ :  Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید

جزئیات محصول:

محل منبع:چين
نام تجاری:SMQ
گواهی:USP,SGS
شماره مدل:86168-78-7

پرداخت:

مقدار حداقل تعداد سفارش:1kg
قیمت:USD 10g
جزئیات بسته بندی:همانطور که شما نیاز دارید
زمان تحویل:1-3 روز
شرایط پرداخت:وسترن یونیون، MoneyGram, T/T
قابلیت ارائه:1000 کیلوگرم در هفته
توضیحات محصول جزئیات
نام: Sermorelin فرمول: C149H246N44O42S
کاربرد: درام پپتیده ظاهر: پودر خشک شده بوسیله انجماد
اسکایپ: nicole0918 ایمیل: 2355935183@ycphar.com

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید

جزئیات سریع:


نام محصول: Sermorelin
مترادف: SERMORELIN؛ SERMORELIN ACETATE؛ YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2؛ TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG -LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2؛ TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY -GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN؛ H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN- SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2؛ HORMONE GROWTH RELEASING FACTOR (1 -29) AMIDE، HUMAN؛ GRF (1-29) AMIDE (انسان)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
دسته بندی محصولات: مشتقات آمینو اسید؛ پپتید؛ تحقیقات GH-RHObesity؛ GH-RH پپتید برای سلول های زیستی؛ عوامل هورمون رشد؛ نوروپپتید ها؛ انتقال نوروپاتی (چاقی)؛ عوامل آزاد سازی
استفاده: مهار کننده اکسیداز گزانتین


فرآیند بسته بندی و تحویل:

1. تحویل: قطعه در عرض 12 ساعت پس از دریافت پرداخت شما تنظیم می شود.
2. بسته بندی: پودرهای استروئیدها به اندازه کافی محکم برای عبور از آداب و رسوم بسته بندی می شوند
3. در سرتاسر جهان با خیال راحت بسته بندی مانند غذاهای سنتی چینی، موارد شستشوی و حمام کردن و سایر تجهیزات، و غیره ...
4. خدمات اضافی: عکس از بسته برای شما ارائه می شود برای جدا کردن استروئیدها.
شماره 5.Tracking پس از آن منتشر خواهد شد ارائه می شود.
خدمات 6.After-sale: هر گونه سوال پس از اینکه شما بسته، لطفا با ما برای اولین بار با ما تماس بگیرید. مشکلات برای شما بلافاصله حل خواهد شد.

مزیت رقابتی:

  1. تجربه غنی در بارگذاری مقدار زیادی ظروف در بندر چینی؛
  2. حمل سریع توسط خطوط حمل و نقل مشهور؛
  3. بسته بندی با پالت با توجه به درخواست ویژه مشتری؛
  4. ارائه بهترین خدمات پس از حمل و نقل توسط پست الکترونیکی؛
  5. محموله همراه با خدمات فروش کانتینر در دسترس؛
  6. ارائه تصاویری از بارها قبل و بعد از بارگیری در ظرف؛
  7. مواد اولیه از منبع چینی؛

محصولات مرتبط:

سری پلیپپتید

نام محصول

مشخصات

MGF

2 میلی گرم / ویل

PEG MGF

2 میلی گرم / ویل

CJC-1295 با DAC

2 میلی گرم / ویل

CJC-1295 بدون DAC

2 میلی گرم / ویل

PT-141

10 میلی گرم / ویل

MT-1

10 میلی گرم / ویل

MT-2

10 میلی گرم / ویل

GHRP-2

10 میلی گرم / ویل

GHRP-2

5 میلی گرم / ویل

GHRP-6

10 میلی گرم / ویل

GHRP-6

5 میلی گرم / ویل

Ipamorelin

2 میلی گرم / ویل

هگزاللین

2 میلی گرم / ویل

Sermorelin

2 میلی گرم / ویل

اکسي توسين

2 میلی گرم / ویل

TB500

2 میلی گرم / ویل

pentadecapeptide BPC 157

2 میلی گرم / ویل

HGH 176-191

2 میلی گرم / ویل

Triptorelin 2 میلی گرم / ویل
تامورلین 2 میلی گرم / ویل
گونادورلین 2 میلی گرم / ویل
گونادورلین 10 میلی گرم / ویل
DSIP 2 میلی گرم / ویل
سلکان 5 میلی گرم / ویل



اطلاعات تماس
Shenzhen Haiwen Biotechnology Co.,Ltd

تماس با شخص: Mrs. Lisa

ارسال درخواست خود را به طور مستقیم به ما (0 / 3000)

سایر محصولات

99.5٪ خلوص بالا Minoxidil USP34 پودر رشد مو CAS 38304-91-5

پودر رشد مو BPH Avodart / Dutasteride 164656-23-9 Duagen

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید

پودر رشد موی Hongdenafil oral crystal CAS 98319-26-7

Steroid PT411 Acetate CAS 32780-32-8 Steroid Growth White Hair Acne Peptide Acid Disaccharide

سلامتی 99٪ پودر رشد مو دوتاسترید Avodart استروئید ضد استروژن

رشد موی طبیعی کریستالی سفید استروئید فیناستراید استروئیدهای ضدستروژن Proscar