شرکت بیوتکنولوژی Huaju ، آموزشی ویبولیتین هست یک تولید کننده پودر استروئیدهای خام ، روغن / قرص های تمام شده ، HGH ، HCG ، پپتیدها و داروهای بی حس کننده محلی در چین.

درخواست نقل قول - Email
Select Language
دربارهی ما
کارخانه تور
کنترل کیفیت
تماس با ما
درخواست نقل قول

پودر رشد مو

من محصولات خود را دریافت کرده ام، بسته بندی کنید، منحصر به فرد و کامل است، آن را واقعا من شگفت زده شده است. من در اسرع وقت بیشتر از شما سفارش. TKS!

—— Robet--Australia

من چندین بار با شما همکاری کرده ام، کیفیت محصول شما بسیار عالی است، به همین دلیل من هنوز محصولات خود را از شما خریداری می کنم. متشکرم

—— Richard---American

سلام مات، بهترین قیمت و محصول خلوص بالا در کشور من بسیار رقابتی است، این اجازه می دهد من سود بسیار، مشتریان من واقعا آن را دوست دارم. tks

—— Johnson---Canada

چت IM آنلاین در حال حاضر

پودر رشد مو

China 99.5٪ خلوص بالا Minoxidil USP34 پودر رشد مو CAS 38304-91-5 distributor

99.5٪ خلوص بالا Minoxidil USP34 پودر رشد مو CAS 38304-91-5

99.5٪ خلوص بالا Minoxidil USP34 پودر رشد مو CAS 38304-91-5 جزئیات سریع: مینوکسیدیل یا سولفات منوکسیدیل نوعی هیپوتانسی، فشار خون را کاهش می دهد، باعث افزایش رشد مو می شود. شرح: مینوکسیدیل CAS شماره: 38304-91-5 ...    ادامه مطلب
2019-03-13 17:06:34
China پودر رشد مو BPH Avodart / Dutasteride 164656-23-9 Duagen distributor

پودر رشد مو BPH Avodart / Dutasteride 164656-23-9 Duagen

پودر رشد مو BPH Avodart / Dutasteride 164656-23-9 Duagen دوتاستراید (آوودارت) نام محصول: Dutasteride وزن مولکولی: L28.5297 InChI: nChI = 1 / C27H30F6N2O2 / 24-21-9-17-15 (4-8-21-25 (17،2) 12-10-22 (36) 35-21) ...    ادامه مطلب
2019-03-13 17:06:29
China Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید distributor

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید

Lyophilized تزریق 2 میلی گرم / ویل رشد مو استروئید Sermorelin پلیپپتید جزئیات سریع: نام محصول: Sermorelin مترادف: SERMORELIN؛ SERMORELIN ACETATE؛ YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2؛ TYR-ALA-ASP-ALA-ILE-PHE-THR...    ادامه مطلب
2019-03-13 17:06:33
China پودر رشد موی Hongdenafil oral crystal CAS 98319-26-7 distributor

پودر رشد موی Hongdenafil oral crystal CAS 98319-26-7

پودر رشد موی هنگدنافیل سفید CAS 98319-26-7 جزئیات سریع: نام محصول هنگدنافیل اسم دیگر آستیلدینافیل شماره ثبت نام CAS 831217-01-7 فرمول مولکولی C25H34N6O3 وزن مولکولی 466.583 ظاهر پودر کریستالی سفید ساختار مولکول...    ادامه مطلب
2019-03-13 17:06:25
China Steroid PT411 Acetate CAS 32780-32-8 Steroid Growth White Hair Acne Peptide Acid Disaccharide distributor

Steroid PT411 Acetate CAS 32780-32-8 Steroid Growth White Hair Acne Peptide Acid Disaccharide

Steroid PT411 Acetate CAS 32780-32-8 Steroid Growth White Hair Acne Peptide Acid Disaccharide جزئیات سریع: Bremelanotide؛ PT-141 شماره CAS: 32780-32-8 MOQ: 20Vials خلوص (HPLC): 98.0٪ دقیقه. فرمول مولکولی: ...    ادامه مطلب
2019-03-13 17:06:27
China سلامتی 99٪ پودر رشد مو دوتاسترید Avodart استروئید ضد استروژن distributor

سلامتی 99٪ پودر رشد مو دوتاسترید Avodart استروئید ضد استروژن

سلامتی 99٪ پودر رشد مو دوتاسترید Avodart استروئید ضد استروژن جزئیات سریع: نام محصول؛ Dutasteride نام مستعار؛ Avodart CAS No.164656-23-9 فرمول مولکولی؛ C27H30F6N2O2 وزن مولکولی؛ 528.53 ظاهر؛ پودر کریستالی سفید ی...    ادامه مطلب
2019-03-13 17:06:20
China رشد موی طبیعی کریستالی سفید استروئید فیناستراید استروئیدهای ضدستروژن Proscar distributor

رشد موی طبیعی کریستالی سفید استروئید فیناستراید استروئیدهای ضدستروژن Proscar

رشد موی طبیعی کریستالی سفید استروئید فیناستراید استروئیدهای ضدستروژن Proscar جزئیات سریع: نام محصول: فیناستراید نام مستعار: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372.55 خلوص: 99.68٪ ظاهر: پودر بلوری بی رنگ...    ادامه مطلب
2019-03-13 17:06:20
China 98319-26-7 پودر رشد مو فیناستراید Propecia درمان کاهش مو distributor

98319-26-7 پودر رشد مو فیناستراید Propecia درمان کاهش مو

98319-26-7 پودر رشد مو فیناستراید Propecia درمان کاهش مو جزئیات سریع: نام محصول فیناستراید شماره رجیستر CAS 98319-26-7 فرمول مولکولی C23H36N2O2 وزن مولکولی 372.5441 InChI : InChI = 1 / C23H36N2O2 / c1-21 (2،3) ...    ادامه مطلب
2019-03-13 17:06:02
China استروئید مینوکسیدیل CAS 38304-91-5 عصاره گیاهی قوی رشد مو distributor

استروئید مینوکسیدیل CAS 38304-91-5 عصاره گیاهی قوی رشد مو

استروئید مینوکسیدیل CAS 38304-91-5 عصاره گیاهی قوی رشد مو عزیز، SMQ چنین صادر کرده است محصولات برای 12 سال، با کیفیت بالا با قیمت خوب و پاسخ سریع ، خوش آمدید برای تماس با ycsmq@yuanchengtech.com اسکایپ: ...    ادامه مطلب
2019-03-13 17:06:09
China پودر رشد طبیعی مو 57-85-2 پودر پروپیونات تستوسترون تستوویرن distributor

پودر رشد طبیعی مو 57-85-2 پودر پروپیونات تستوسترون تستوویرن

پودر رشد طبیعی مو 57-85-2 پودر پروپیونات تستوسترون تستوویرن 1. جزئیات سریع: نام انگلیسی: Propionate Testosterone نام انگلیسی: 17beta- (Propionyloxy) androst-4-en-3-one؛ 17-بتا هیدروکسی 4-آندستسن-3-یک 17-پروپیون...    ادامه مطلب
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|